Lineage for d1oy7a_ (1oy7 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751665Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 751666Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 751667Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)
  6. 751716Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 751717Species Human (Homo sapiens) [TaxId:9606] [103631] (6 PDB entries)
  8. 751734Domain d1oy7a_: 1oy7 A: [93721]

Details for d1oy7a_

PDB Entry: 1oy7 (more details), 2.7 Å

PDB Description: Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 7

SCOP Domain Sequences for d1oy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy7a_ g.52.1.1 (A:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqet

SCOP Domain Coordinates for d1oy7a_:

Click to download the PDB-style file with coordinates for d1oy7a_.
(The format of our PDB-style files is described here.)

Timeline for d1oy7a_: