Class g: Small proteins [56992] (85 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins) |
Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103631] (6 PDB entries) |
Domain d1oy7a_: 1oy7 A: [93721] |
PDB Entry: 1oy7 (more details), 2.7 Å
SCOP Domain Sequences for d1oy7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy7a_ g.52.1.1 (A:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqet
Timeline for d1oy7a_:
View in 3D Domains from other chains: (mouse over for more information) d1oy7b_, d1oy7c_, d1oy7d_, d1oy7e_ |