Lineage for d1oy2a_ (1oy2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467483Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)
  6. 467519Protein Shc adaptor protein [50760] (1 species)
  7. 467520Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries)
  8. 467521Domain d1oy2a_: 1oy2 A: [93717]

Details for d1oy2a_

PDB Entry: 1oy2 (more details)

PDB Description: coupling of folding and binding in the ptb domain of the signaling protein shc

SCOP Domain Sequences for d1oy2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens)}
gqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtq
vtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstsslnlmaa
dckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvistigq
afelrfkqylr

SCOP Domain Coordinates for d1oy2a_:

Click to download the PDB-style file with coordinates for d1oy2a_.
(The format of our PDB-style files is described here.)

Timeline for d1oy2a_: