Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein Shc adaptor protein [50760] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries) |
Domain d1oy2a_: 1oy2 A: [93717] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1oy2 (more details)
SCOPe Domain Sequences for d1oy2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} gqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtq vtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstsslnlmaa dckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvistigq afelrfkqylr
Timeline for d1oy2a_: