Lineage for d1oxxk1 (1oxx K:243-352)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060894Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2060978Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2060979Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species)
  7. 2060980Species Sulfolobus solfataricus [TaxId:2287] [89336] (5 PDB entries)
  8. 2060981Domain d1oxxk1: 1oxx K:243-352 [93715]
    Other proteins in same PDB: d1oxxk2
    complexed with iod

Details for d1oxxk1

PDB Entry: 1oxx (more details), 1.45 Å

PDB Description: crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
PDB Compounds: (K:) ABC transporter, ATP binding protein

SCOPe Domain Sequences for d1oxxk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxxk1 b.40.6.3 (K:243-352) Glucose transport protein GlcV, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk
vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfek

SCOPe Domain Coordinates for d1oxxk1:

Click to download the PDB-style file with coordinates for d1oxxk1.
(The format of our PDB-style files is described here.)

Timeline for d1oxxk1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oxxk2