Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [89336] (5 PDB entries) |
Domain d1oxxk1: 1oxx K:243-352 [93715] Other proteins in same PDB: d1oxxk2 complexed with iod |
PDB Entry: 1oxx (more details), 1.45 Å
SCOPe Domain Sequences for d1oxxk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxxk1 b.40.6.3 (K:243-352) Glucose transport protein GlcV, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfek
Timeline for d1oxxk1: