Lineage for d1oxra_ (1oxr A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361370Species Indian cobra (Naja naja sagittifera), isoform 4 [TaxId:195058] [89171] (4 PDB entries)
  8. 361373Domain d1oxra_: 1oxr A: [93714]
    complexed with aspirin
    complexed with ain, ca

Details for d1oxra_

PDB Entry: 1oxr (more details), 1.93 Å

PDB Description: aspirin induces its anti-inflammatory effects through its specific binding to phospholipase a2: crystal structure of the complex formed between phospholipase a2 and aspirin at 1.9a resolution

SCOP Domain Sequences for d1oxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxra_ a.133.1.2 (A:) Snake phospholipase A2 {Indian cobra (Naja naja sagittifera), isoform 4}
nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOP Domain Coordinates for d1oxra_:

Click to download the PDB-style file with coordinates for d1oxra_.
(The format of our PDB-style files is described here.)

Timeline for d1oxra_: