Lineage for d1oxra_ (1oxr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733055Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries)
    Uniprot P60045 8-126 # ! yet another isoform, 98% identity
  8. 2733065Domain d1oxra_: 1oxr A: [93714]
    complexed with aspirin
    complexed with ain, ca

Details for d1oxra_

PDB Entry: 1oxr (more details), 1.93 Å

PDB Description: aspirin induces its anti-inflammatory effects through its specific binding to phospholipase a2: crystal structure of the complex formed between phospholipase a2 and aspirin at 1.9a resolution
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d1oxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxra_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOPe Domain Coordinates for d1oxra_:

Click to download the PDB-style file with coordinates for d1oxra_.
(The format of our PDB-style files is described here.)

Timeline for d1oxra_: