Lineage for d1oxqc_ (1oxq C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967381Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1967382Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1967383Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1967476Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 1967477Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
    Uniprot Q96CA5 78-159
  8. 1967493Domain d1oxqc_: 1oxq C: [93711]
    complexed with a peptide antagonist, chain F
    complexed with p33, zn

Details for d1oxqc_

PDB Entry: 1oxq (more details), 2.3 Å

PDB Description: Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)
PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d1oxqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxqc_ g.52.1.1 (C:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeths

SCOPe Domain Coordinates for d1oxqc_:

Click to download the PDB-style file with coordinates for d1oxqc_.
(The format of our PDB-style files is described here.)

Timeline for d1oxqc_: