| Class g: Small proteins [56992] (72 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins) |
| Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [103631] (3 PDB entries) |
| Domain d1oxqb_: 1oxq B: [93710] |
PDB Entry: 1oxq (more details), 2.3 Å
SCOP Domain Sequences for d1oxqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxqb_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens)}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeths
Timeline for d1oxqb_:
View in 3DDomains from other chains: (mouse over for more information) d1oxqa_, d1oxqc_, d1oxqd_, d1oxqe_ |