Lineage for d1oxqb_ (1oxq B:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430707Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 430708Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 430709Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins)
  6. 430749Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 430750Species Human (Homo sapiens) [TaxId:9606] [103631] (3 PDB entries)
  8. 430757Domain d1oxqb_: 1oxq B: [93710]

Details for d1oxqb_

PDB Entry: 1oxq (more details), 2.3 Å

PDB Description: Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)

SCOP Domain Sequences for d1oxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxqb_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens)}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeths

SCOP Domain Coordinates for d1oxqb_:

Click to download the PDB-style file with coordinates for d1oxqb_.
(The format of our PDB-style files is described here.)

Timeline for d1oxqb_: