Class g: Small proteins [56992] (85 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins) |
Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103631] (6 PDB entries) |
Domain d1oxne_: 1oxn E: [93708] complexed with a peptide antagonist, chain F complexed with p33, zn |
PDB Entry: 1oxn (more details), 2.2 Å
SCOP Domain Sequences for d1oxne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxne_ g.52.1.1 (E:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg ddpwtehakwfpscqfllrskgrdfvhsvqeths
Timeline for d1oxne_:
View in 3D Domains from other chains: (mouse over for more information) d1oxna_, d1oxnb_, d1oxnc_, d1oxnd_ |