Lineage for d1oxlb_ (1oxl B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015938Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (38 PDB entries)
    Uniprot P59071
  8. 2015962Domain d1oxlb_: 1oxl B: [93703]
    complexed with co3, ida, so4

Details for d1oxlb_

PDB Entry: 1oxl (more details), 1.8 Å

PDB Description: inhibition of phospholipase a2 (pla2) by (2-carbamoylmethyl-5-propyl- octahydro-indol-7-yl)-acetic acid (indole): crystal structure of the complex formed between pla2 from russell's viper and indole at 1.8 resolution
PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1oxlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxlb_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1oxlb_:

Click to download the PDB-style file with coordinates for d1oxlb_.
(The format of our PDB-style files is described here.)

Timeline for d1oxlb_: