SCOP 1.73: Domain d1oxla_: 1oxl A:

Lineage for d1oxla_ (1oxl A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries)

8. Domain d1oxla_: 1oxl A: [93702]

Details for d1oxla_

PDB Entry: 1oxl, 1.8 Å

PDB Description: inhibition of phospholipase a2 (pla2) by (2-carbamoylmethyl-5-propyl- octahydro-indol-7-yl)-acetic acid (indole): crystal structure of the complex formed between pla2 from russell's viper and indole at 1.8 resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d1oxla_:

Sequence; same for both SEQRES and ATOM records:

>d1oxla_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1oxla_:

• d1oxla_ first appeared in SCOP 1.67
  
• d1oxla_ appears in SCOP 1.71
  
• d1oxla_ appears in SCOP 1.75
  
• d1oxla_ appears in the current release, SCOPe 2.08