Lineage for d1oxla_ (1oxl A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361434Species Snake (Daboia russelli pulchella) [48630] (15 PDB entries)
  8. 361442Domain d1oxla_: 1oxl A: [93702]

Details for d1oxla_

PDB Entry: 1oxl (more details), 1.8 Å

PDB Description: inhibition of phospholipase a2 (pla2) by (2-carbamoylmethyl-5-propyl- octahydro-indol-7-yl)-acetic acid (indole): crystal structure of the complex formed between pla2 from russell's viper and indole at 1.8 resolution

SCOP Domain Sequences for d1oxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxla_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1oxla_:

Click to download the PDB-style file with coordinates for d1oxla_.
(The format of our PDB-style files is described here.)

Timeline for d1oxla_: