Lineage for d1oxkl_ (1oxk L:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481070Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 481071Family c.23.1.1: CheY-related [52173] (17 proteins)
  6. 481200Protein Response regulator Sin1 [102228] (1 species)
  7. 481201Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102229] (2 PDB entries)
  8. 481208Domain d1oxkl_: 1oxk L: [93701]
    Other proteins in same PDB: d1oxka_, d1oxkc_, d1oxke_, d1oxkg_, d1oxki_, d1oxkk_

Details for d1oxkl_

PDB Entry: 1oxk (more details), 2.1 Å

PDB Description: Complex between YPD1 and SLN1 response regulator domain in space group P3(2)

SCOP Domain Sequences for d1oxkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxkl_ c.23.1.1 (L:) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae)}
svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
tefcaayq

SCOP Domain Coordinates for d1oxkl_:

Click to download the PDB-style file with coordinates for d1oxkl_.
(The format of our PDB-style files is described here.)

Timeline for d1oxkl_: