Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) contains additional, fifth helix at the N-terminus |
Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins) |
Protein Phosphorelay protein ypd1 [47231] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries) |
Domain d1oxki_: 1oxk I: [93698] Other proteins in same PDB: d1oxkb_, d1oxkd_, d1oxkf_, d1oxkh_, d1oxkj_, d1oxkl_ complexed with so4 |
PDB Entry: 1oxk (more details), 2.1 Å
SCOPe Domain Sequences for d1oxki_:
Sequence, based on SEQRES records: (download)
>d1oxki_ a.24.10.2 (I:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
>d1oxki_ a.24.10.2 (I:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik densiyliliakalnqsrlefklarielskyyntnl
Timeline for d1oxki_: