SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1oxki_ (1oxk I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987880Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 1987888Family a.24.10.2: Phosphorelay protein-like [47230] (3 protein domains)
  6. 1987901Protein Phosphorelay protein ypd1 [47231] (1 species)
  7. 1987902Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)
  8. 1987910Domain d1oxki_: 1oxk I: [93698]
    Other proteins in same PDB: d1oxkb_, d1oxkd_, d1oxkf_, d1oxkh_, d1oxkj_, d1oxkl_
    complexed with so4

Details for d1oxki_

PDB Entry: 1oxk (more details), 2.1 Å

PDB Description: Complex between YPD1 and SLN1 response regulator domain in space group P3(2)
PDB Compounds: (I:) Ypd1p

SCOPe Domain Sequences for d1oxki_:

Sequence, based on SEQRES records: (download)

>d1oxki_ a.24.10.2 (I:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

Sequence, based on observed residues (ATOM records): (download)

>d1oxki_ a.24.10.2 (I:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
densiyliliakalnqsrlefklarielskyyntnl

SCOPe Domain Coordinates for d1oxki_:

Click to download the PDB-style file with coordinates for d1oxki_.
(The format of our PDB-style files is described here.)

Timeline for d1oxki_: