SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1oxkd_ (1oxk D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101799Protein Response regulator Sin1 [102228] (1 species)
  7. 2101800Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102229] (2 PDB entries)
  8. 2101802Domain d1oxkd_: 1oxk D: [93693]
    Other proteins in same PDB: d1oxka_, d1oxkc_, d1oxke_, d1oxkg_, d1oxki_, d1oxkk_
    complexed with so4

Details for d1oxkd_

PDB Entry: 1oxk (more details), 2.1 Å

PDB Description: Complex between YPD1 and SLN1 response regulator domain in space group P3(2)
PDB Compounds: (D:) sln1

SCOPe Domain Sequences for d1oxkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxkd_ c.23.1.1 (D:) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
tefcaayq

SCOPe Domain Coordinates for d1oxkd_:

Click to download the PDB-style file with coordinates for d1oxkd_.
(The format of our PDB-style files is described here.)

Timeline for d1oxkd_: