SCOPe 2.07: Domain d1oxbb_: 1oxb B:

Lineage for d1oxbb_ (1oxb B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulator Sin1 [102228] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102229] (2 PDB entries)

8. Domain d1oxbb_: 1oxb B: [93682]
   Other proteins in same PDB: d1oxba_
   complexed with so4

Details for d1oxbb_

PDB Entry: 1oxb, 2.3 Å

PDB Description: Complex between YPD1 and SLN1 response regulator domain in space group P2(1)2(1)2(1)

PDB Compounds: (B:) sln1

SCOPe Domain Sequences for d1oxbb_:

Sequence; same for both SEQRES and ATOM records:

>d1oxbb_ c.23.1.1 (B:) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
tefc

Timeline for d1oxbb_:

• d1oxbb_ first appeared in SCOP 1.67
  
• d1oxbb_ appears in SCOPe 2.06
  
• d1oxbb_ appears in the current release, SCOPe 2.08