Lineage for d1ox9h_ (1ox9 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824646Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2824647Superfamily b.136.1: SspB-like [101738] (3 families) (S)
  5. 2824648Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
    automatically mapped to Pfam PF04386
  6. 2824649Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 2824650Species Escherichia coli [TaxId:562] [101741] (2 PDB entries)
  8. 2824660Domain d1ox9h_: 1ox9 H: [93680]
    complexed with a SsrA peptide; chains I, J, K, L, M, N, O and P

Details for d1ox9h_

PDB Entry: 1ox9 (more details), 2.9 Å

PDB Description: Crystal structure of SspB-ssrA complex
PDB Compounds: (H:) Stringent starvation protein B

SCOPe Domain Sequences for d1ox9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox9h_ b.136.1.1 (H:) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]}
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

SCOPe Domain Coordinates for d1ox9h_:

Click to download the PDB-style file with coordinates for d1ox9h_.
(The format of our PDB-style files is described here.)

Timeline for d1ox9h_: