Lineage for d1ox9g_ (1ox9 G:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680685Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 680686Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) (S)
  5. 680687Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 680688Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 680689Species Escherichia coli [TaxId:562] [101741] (3 PDB entries)
  8. 680702Domain d1ox9g_: 1ox9 G: [93679]

Details for d1ox9g_

PDB Entry: 1ox9 (more details), 2.9 Å

PDB Description: Crystal structure of SspB-ssrA complex
PDB Compounds: (G:) Stringent starvation protein B

SCOP Domain Sequences for d1ox9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox9g_ b.136.1.1 (G:) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]}
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

SCOP Domain Coordinates for d1ox9g_:

Click to download the PDB-style file with coordinates for d1ox9g_.
(The format of our PDB-style files is described here.)

Timeline for d1ox9g_: