Class b: All beta proteins [48724] (177 folds) |
Fold b.136: SspB-like [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
Superfamily b.136.1: SspB-like [101738] (3 families) |
Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins) automatically mapped to Pfam PF04386 |
Protein Stringent starvation protein B, SspB [101740] (2 species) a specificity-enhancing factor for the ClpXP proteolytic machine |
Species Escherichia coli [TaxId:562] [101741] (2 PDB entries) |
Domain d1ox9e_: 1ox9 E: [93677] complexed with a SsrA peptide; chains I, J, K, L, M, N, O and P |
PDB Entry: 1ox9 (more details), 2.9 Å
SCOPe Domain Sequences for d1ox9e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox9e_ b.136.1.1 (E:) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]} sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
Timeline for d1ox9e_: