Class b: All beta proteins [48724] (141 folds) |
Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) |
Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein) |
Protein Stringent starvation protein B, SspB [101740] (2 species) a specificity-enhancing factor for the ClpXP proteolytic machine |
Species Escherichia coli [TaxId:562] [101741] (2 PDB entries) |
Domain d1ox9a_: 1ox9 A: [93673] |
PDB Entry: 1ox9 (more details), 2.9 Å
SCOP Domain Sequences for d1ox9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox9a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Escherichia coli} sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
Timeline for d1ox9a_: