![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
![]() | Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) ![]() |
![]() | Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein) |
![]() | Protein Stringent starvation protein B, SspB [101740] (2 species) a specificity-enhancing factor for the ClpXP proteolytic machine |
![]() | Species Escherichia coli [TaxId:562] [101741] (2 PDB entries) |
![]() | Domain d1ox8b_: 1ox8 B: [93672] |
PDB Entry: 1ox8 (more details), 2.2 Å
SCOP Domain Sequences for d1ox8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox8b_ b.136.1.1 (B:) Stringent starvation protein B, SspB {Escherichia coli} qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
Timeline for d1ox8b_: