Lineage for d1ox8b_ (1ox8 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473105Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 473106Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) (S)
  5. 473107Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 473108Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 473109Species Escherichia coli [TaxId:562] [101741] (2 PDB entries)
  8. 473111Domain d1ox8b_: 1ox8 B: [93672]

Details for d1ox8b_

PDB Entry: 1ox8 (more details), 2.2 Å

PDB Description: Crystal structure of SspB

SCOP Domain Sequences for d1ox8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox8b_ b.136.1.1 (B:) Stringent starvation protein B, SspB {Escherichia coli}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

SCOP Domain Coordinates for d1ox8b_:

Click to download the PDB-style file with coordinates for d1ox8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ox8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ox8a_