Lineage for d1ox8b_ (1ox8 B:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like foldSuperfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) 
Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein) Protein Stringent starvation protein B, SspB [101740] (2 species)
a specificity-enhancing factor for the ClpXP proteolytic machine
Species Escherichia coli [TaxId:562] [101741] (2 PDB entries) 
Domain d1ox8b_: 1ox8 B: [93672]
Details for d1ox8b_
PDB Entry: 1ox8 (more details), 2.2 Å
PDB Description: Crystal structure of SspB
SCOP Domain Sequences for d1ox8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox8b_ b.136.1.1 (B:) Stringent starvation protein B, SspB {Escherichia coli}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
SCOP Domain Coordinates for d1ox8b_:
Click to download the PDB-style file with coordinates for d1ox8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ox8b_:
- d1ox8b_ is new in SCOP 1.67
- d1ox8b_ appears in SCOP 1.69
- d1ox8b_ appears in the current release, SCOPe 2.08
View in 3D
