Lineage for d1ox7b_ (1ox7 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882436Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1882437Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1882512Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 1882517Protein Cytosine deaminase [89801] (1 species)
  7. 1882518Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries)
  8. 1882522Domain d1ox7b_: 1ox7 B: [93670]
    complexed with ca, zn

Details for d1ox7b_

PDB Entry: 1ox7 (more details), 1.43 Å

PDB Description: Crystal structure of yeast cytosine deaminase apo-enzyme: inorganic zinc bound
PDB Compounds: (B:) Cytosine deaminase

SCOPe Domain Sequences for d1ox7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox7b_ c.97.1.2 (B:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
gekylqtrghevvvvdderckkimkqfiderpqdwfedige

SCOPe Domain Coordinates for d1ox7b_:

Click to download the PDB-style file with coordinates for d1ox7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ox7b_: