SCOPe 2.06: Domain d1ox7a_: 1ox7 A:

Lineage for d1ox7a_ (1ox7 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries)

8. Domain d1ox7a_: 1ox7 A: [93669]
   Other proteins in same PDB: d1ox7b2
   complexed with ca, zn

Details for d1ox7a_

PDB Entry: 1ox7, 1.43 Å

PDB Description: Crystal structure of yeast cytosine deaminase apo-enzyme: inorganic zinc bound

PDB Compounds: (A:) Cytosine deaminase

SCOPe Domain Sequences for d1ox7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ox7a_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek
ylqtrghevvvvdderckkimkqfiderpqdwfedige

Timeline for d1ox7a_:

• d1ox7a_ first appeared in SCOP 1.67
  
• d1ox7a_ appears in SCOPe 2.05
  
• d1ox7a_ appears in SCOPe 2.07
  
• d1ox7a_ appears in the current release, SCOPe 2.08