Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.17: Fibritin [58046] (1 family) |
Family h.1.17.1: Fibritin [58047] (1 protein) |
Protein Fibritin [58048] (2 species) biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet |
Species Bacteriophage T4 [TaxId:10665] [58049] (7 PDB entries) Uniprot P10104 |
Domain d1ox3a_: 1ox3 A: [93668] mini-fibritin mutant beta-hairpin triplet (foldon) only; no coiled-coil structure |
PDB Entry: 1ox3 (more details), 2 Å
SCOPe Domain Sequences for d1ox3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox3a_ h.1.17.1 (A:) Fibritin {Bacteriophage T4 [TaxId: 10665]} divlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldkn igilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl
Timeline for d1ox3a_: