SCOPe 2.01: Domain d1owrq2: 1owr Q:395-575

Lineage for d1owrq2 (1owr Q:395-575)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (7 families)
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
Domain d1owrq2: 1owr Q:395-575 [93664]
Other proteins in same PDB: d1owrm1, d1owrn1, d1owrp1, d1owrq1
protein/DNA complex

Details for d1owrq2

PDB Description: crystal structure of human nfat1 bound monomerically to dna

PDB Compounds: (Q:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1owrq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrq2 b.2.5.3 (Q:395-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
h

SCOPe Domain Coordinates for d1owrq2:

Click to download the PDB-style file with coordinates for d1owrq2.
(The format of our PDB-style files is described here.)

Timeline for d1owrq2: