| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
| Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
| Domain d1owrq2: 1owr Q:396-575 [93664] Other proteins in same PDB: d1owrm1, d1owrm3, d1owrn1, d1owrn3, d1owrp1, d1owrp3, d1owrq1, d1owrq3 protein/DNA complex |
PDB Entry: 1owr (more details), 3 Å
SCOPe Domain Sequences for d1owrq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owrq2 b.2.5.3 (Q:396-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplg
lqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidc
agilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah
Timeline for d1owrq2: