Lineage for d1owrq1 (1owr Q:576-678)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 367735Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 367787Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 367788Species Human (Homo sapiens) [TaxId:9606] [49247] (4 PDB entries)
  8. 367797Domain d1owrq1: 1owr Q:576-678 [93663]
    Other proteins in same PDB: d1owrm2, d1owrn2, d1owrp2, d1owrq2

Details for d1owrq1

PDB Entry: 1owr (more details), 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna

SCOP Domain Sequences for d1owrq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrq1 b.1.18.1 (Q:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens)}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1owrq1:

Click to download the PDB-style file with coordinates for d1owrq1.
(The format of our PDB-style files is described here.)

Timeline for d1owrq1: