Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
Domain d1owrp2: 1owr P:396-575 [93662] Other proteins in same PDB: d1owrm1, d1owrm3, d1owrn1, d1owrn3, d1owrp1, d1owrp3, d1owrq1, d1owrq3 protein/DNA complex |
PDB Entry: 1owr (more details), 3 Å
SCOPe Domain Sequences for d1owrp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owrp2 b.2.5.3 (P:396-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} plewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplg lqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidc agilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah
Timeline for d1owrp2: