Lineage for d1owrp1 (1owr P:576-678)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299387Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 1299465Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 1299466Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. 1299479Domain d1owrp1: 1owr P:576-678 [93661]
    Other proteins in same PDB: d1owrm2, d1owrn2, d1owrp2, d1owrq2
    protein/DNA complex

Details for d1owrp1

PDB Entry: 1owr (more details), 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna
PDB Compounds: (P:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1owrp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrp1 b.1.18.1 (P:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOPe Domain Coordinates for d1owrp1:

Click to download the PDB-style file with coordinates for d1owrp1.
(The format of our PDB-style files is described here.)

Timeline for d1owrp1: