Lineage for d1owrp1 (1owr P:576-678)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456111Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 456175Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 456176Species Human (Homo sapiens) [TaxId:9606] [49247] (4 PDB entries)
  8. 456184Domain d1owrp1: 1owr P:576-678 [93661]
    Other proteins in same PDB: d1owrm2, d1owrn2, d1owrp2, d1owrq2

Details for d1owrp1

PDB Entry: 1owr (more details), 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna

SCOP Domain Sequences for d1owrp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrp1 b.1.18.1 (P:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens)}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1owrp1:

Click to download the PDB-style file with coordinates for d1owrp1.
(The format of our PDB-style files is described here.)

Timeline for d1owrp1: