Lineage for d1owrn2 (1owr N:395-575)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938790Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 938916Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 938961Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 938962Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 938974Domain d1owrn2: 1owr N:395-575 [93660]
    Other proteins in same PDB: d1owrm1, d1owrn1, d1owrp1, d1owrq1
    protein/DNA complex

Details for d1owrn2

PDB Entry: 1owr (more details), 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna
PDB Compounds: (N:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1owrn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrn2 b.2.5.3 (N:395-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
h

SCOPe Domain Coordinates for d1owrn2:

Click to download the PDB-style file with coordinates for d1owrn2.
(The format of our PDB-style files is described here.)

Timeline for d1owrn2: