| Class b: All beta proteins [48724] (144 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
| Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49422] (6 PDB entries) |
| Domain d1owrn2: 1owr N:395-575 [93660] Other proteins in same PDB: d1owrm1, d1owrn1, d1owrp1, d1owrq1 |
PDB Entry: 1owr (more details), 3 Å
SCOP Domain Sequences for d1owrn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owrn2 b.2.5.3 (N:395-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens)}
vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
h
Timeline for d1owrn2: