SCOP 1.73: Domain d1owrn1: 1owr N:576-678

Lineage for d1owrn1 (1owr N:576-678)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)

8. Domain d1owrn1: 1owr N:576-678 [93659]
   Other proteins in same PDB: d1owrm2, d1owrn2, d1owrp2, d1owrq2

Details for d1owrn1

PDB Entry: 1owr, 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna

PDB Compounds: (N:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1owrn1:

Sequence; same for both SEQRES and ATOM records:

>d1owrn1 b.1.18.1 (N:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d1owrn1:

• d1owrn1 first appeared in SCOP 1.67
  
• d1owrn1 appears in SCOP 1.71
  
• d1owrn1 appears in SCOP 1.75
  
• d1owrn1 appears in the current release, SCOPe 2.08