Lineage for d1owrm2 (1owr M:395-575)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659552Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 659607Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 659650Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 659651Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 659662Domain d1owrm2: 1owr M:395-575 [93658]
    Other proteins in same PDB: d1owrm1, d1owrn1, d1owrp1, d1owrq1

Details for d1owrm2

PDB Entry: 1owr (more details), 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna
PDB Compounds: (M:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1owrm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrm2 b.2.5.3 (M:395-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
h

SCOP Domain Coordinates for d1owrm2:

Click to download the PDB-style file with coordinates for d1owrm2.
(The format of our PDB-style files is described here.)

Timeline for d1owrm2: