Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) automatically mapped to Pfam PF00875 |
Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) |
Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
Species Synechococcus elongatus [TaxId:32046] [52429] (7 PDB entries) Uniprot P05327 1-474 cofactor is HDF |
Domain d1owoa2: 1owo A:2-204 [93654] Other proteins in same PDB: d1owoa1 complexed with fad, po4 |
PDB Entry: 1owo (more details), 2.3 Å
SCOPe Domain Sequences for d1owoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owoa2 c.28.1.1 (A:2-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta iaplllselptlkqlgfdwdggf
Timeline for d1owoa2: