Lineage for d1owna1 (1own A:205-475)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358760Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 358761Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 358762Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 358763Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 358764Species Anacystis nidulans [48177] (6 PDB entries)
  8. 358769Domain d1owna1: 1own A:205-475 [93651]
    Other proteins in same PDB: d1owna2
    complexed with fad, po4

Details for d1owna1

PDB Entry: 1own (more details), 2.3 Å

PDB Description: DATA3:DNA photolyase / received X-rays dose 4.8 exp15 photons/mm2

SCOP Domain Sequences for d1owna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owna1 a.99.1.1 (A:205-475) C-terminal domain of DNA photolyase {Anacystis nidulans}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai

SCOP Domain Coordinates for d1owna1:

Click to download the PDB-style file with coordinates for d1owna1.
(The format of our PDB-style files is described here.)

Timeline for d1owna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1owna2