Lineage for d1owma2 (1owm A:2-204)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392603Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 392604Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 392605Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 392610Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 392611Species Anacystis nidulans [52429] (6 PDB entries)
    cofactor is HDF
  8. 392615Domain d1owma2: 1owm A:2-204 [93650]
    Other proteins in same PDB: d1owma1
    complexed with fad, po4

Details for d1owma2

PDB Entry: 1owm (more details), 2.3 Å

PDB Description: DATA1:DNA photolyase / received X-rays dose 1.2 exp15 photons/mm2

SCOP Domain Sequences for d1owma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owma2 c.28.1.1 (A:2-204) DNA photolyase {Anacystis nidulans}
aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
iaplllselptlkqlgfdwdggf

SCOP Domain Coordinates for d1owma2:

Click to download the PDB-style file with coordinates for d1owma2.
(The format of our PDB-style files is described here.)

Timeline for d1owma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1owma1