Lineage for d1owla1 (1owl A:205-475)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358760Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 358761Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 358762Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 358763Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 358764Species Anacystis nidulans [48177] (6 PDB entries)
  8. 358765Domain d1owla1: 1owl A:205-475 [93647]
    Other proteins in same PDB: d1owla2
    complexed with fad, po4

Details for d1owla1

PDB Entry: 1owl (more details), 1.8 Å

PDB Description: Structure of apophotolyase from Anacystis nidulans

SCOP Domain Sequences for d1owla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owla1 a.99.1.1 (A:205-475) C-terminal domain of DNA photolyase {Anacystis nidulans}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai

SCOP Domain Coordinates for d1owla1:

Click to download the PDB-style file with coordinates for d1owla1.
(The format of our PDB-style files is described here.)

Timeline for d1owla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1owla2