SCOPe 2.05: Domain d1owka_: 1owk A:

Lineage for d1owka_ (1owk A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (72 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d1owka_: 1owk A: [93646]
   complexed with 303

Details for d1owka_

PDB Entry: 1owk, 2.8 Å

PDB Description: substituted 2-naphthamidine inhibitors of urokinase

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1owka_:

Sequence; same for both SEQRES and ATOM records:

>d1owka_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
clpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

Timeline for d1owka_:

• d1owka_ first appeared in SCOP 1.67
  
• d1owka_ appears in SCOPe 2.04
  
• d1owka_ appears in SCOPe 2.06
  
• d1owka_ appears in the current release, SCOPe 2.08