Lineage for d1owja_ (1owj A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 466154Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 466155Species Human (Homo sapiens) [TaxId:9606] [50587] (35 PDB entries)
  8. 466191Domain d1owja_: 1owj A: [93645]

Details for d1owja_

PDB Entry: 1owj (more details), 3.1 Å

PDB Description: substituted 2-naphthamidine inhibitors of urokinase

SCOP Domain Sequences for d1owja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owja_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
clpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOP Domain Coordinates for d1owja_:

Click to download the PDB-style file with coordinates for d1owja_.
(The format of our PDB-style files is described here.)

Timeline for d1owja_: