Lineage for d1owea_ (1owe A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803442Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 803443Species Human (Homo sapiens) [TaxId:9606] [50587] (49 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 803447Domain d1owea_: 1owe A: [93642]
    complexed with 675, so4

Details for d1owea_

PDB Entry: 1owe (more details), 1.6 Å

PDB Description: substituted 2-naphthamidine inhibitors of urokinase
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOP Domain Sequences for d1owea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owea_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
clpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOP Domain Coordinates for d1owea_:

Click to download the PDB-style file with coordinates for d1owea_.
(The format of our PDB-style files is described here.)

Timeline for d1owea_: