Lineage for d1owaa_ (1owa A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534474Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 534475Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
  6. 534488Protein Spectrin alpha chain [46968] (3 species)
  7. 534508Species Human (Homo sapiens) [TaxId:9606] [101077] (1 PDB entry)
  8. 534509Domain d1owaa_: 1owa A: [93640]
    N-terminal repeat; includes extra N-terminal helix; tetramerisation region

Details for d1owaa_

PDB Entry: 1owa (more details)

PDB Description: Solution Structural Studies on Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain

SCOP Domain Sequences for d1owaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens)}
meqfpketvvessgpkvletaeeiqerrqevltryqsfkervaergqkledsyhlqvfkr
daddlgkwimekvniltdksyedptniqgkyqkhqsleaevqtksrlmselektreerft
mghsaheetkahieelrhlwdllleltlekgdqllr

SCOP Domain Coordinates for d1owaa_:

Click to download the PDB-style file with coordinates for d1owaa_.
(The format of our PDB-style files is described here.)

Timeline for d1owaa_: