Lineage for d1owaa_ (1owa A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696504Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2696505Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 2696522Protein Spectrin alpha chain [46968] (3 species)
  7. 2696542Species Human (Homo sapiens) [TaxId:9606] [101077] (1 PDB entry)
  8. 2696543Domain d1owaa_: 1owa A: [93640]
    N-terminal repeat; includes extra N-terminal helix; tetramerisation region
    has additional insertions and/or extensions that are not grouped together

Details for d1owaa_

PDB Entry: 1owa (more details)

PDB Description: Solution Structural Studies on Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain
PDB Compounds: (A:) Spectrin alpha chain, erythrocyte

SCOPe Domain Sequences for d1owaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]}
meqfpketvvessgpkvletaeeiqerrqevltryqsfkervaergqkledsyhlqvfkr
daddlgkwimekvniltdksyedptniqgkyqkhqsleaevqtksrlmselektreerft
mghsaheetkahieelrhlwdllleltlekgdqllr

SCOPe Domain Coordinates for d1owaa_:

Click to download the PDB-style file with coordinates for d1owaa_.
(The format of our PDB-style files is described here.)

Timeline for d1owaa_: