SCOPe 2.06: Domain d1ow4b1: 1ow4 B:1-118

Lineage for d1ow4b1 (1ow4 B:1-118)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Pheromone binding protein PBPLma [101188] (1 species)

7. Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)

8. Domain d1ow4b1: 1ow4 B:1-118 [93629]
   Other proteins in same PDB: d1ow4a2, d1ow4b2
   complexed with 2an, gol

Details for d1ow4b1

PDB Entry: 1ow4, 1.6 Å

PDB Description: Crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with the fluorescent reporter ANS (1-anilinonaphtalene-8-sulfonic acid),

PDB Compounds: (B:) pheromone binding protein

SCOPe Domain Sequences for d1ow4b1:

Sequence; same for both SEQRES and ATOM records:

>d1ow4b1 a.39.2.1 (B:1-118) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

Timeline for d1ow4b1:

• d1ow4b1 first appeared in SCOP 1.67, called d1ow4b_
  
• d1ow4b1 was called d1ow4b_ in SCOPe 2.05
  
• d1ow4b1 appears in SCOPe 2.07
  
• d1ow4b1 appears in the current release, SCOPe 2.08