Lineage for d1ow4a_ (1ow4 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1269819Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1269820Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1269858Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 1269859Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 1269862Domain d1ow4a_: 1ow4 A: [93628]
    complexed with 2an, gol

Details for d1ow4a_

PDB Entry: 1ow4 (more details), 1.6 Å

PDB Description: Crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with the fluorescent reporter ANS (1-anilinonaphtalene-8-sulfonic acid),
PDB Compounds: (A:) pheromone binding protein

SCOPe Domain Sequences for d1ow4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow4a_ a.39.2.1 (A:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
nsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispe
gaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

SCOPe Domain Coordinates for d1ow4a_:

Click to download the PDB-style file with coordinates for d1ow4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ow4a_: