Lineage for d1ow1a_ (1ow1 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473056Fold b.131: SPOC domain-like [100938] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 473057Superfamily b.131.1: SPOC domain-like [100939] (3 families) (S)
  5. 473068Family b.131.1.3: SPOC domain [101856] (1 protein)
  6. 473069Protein SMART/HDAC1 associated repressor protein, SHARP [101857] (1 species)
  7. 473070Species Human (Homo sapiens) [TaxId:9606] [101858] (1 PDB entry)
  8. 473071Domain d1ow1a_: 1ow1 A: [93625]

Details for d1ow1a_

PDB Entry: 1ow1 (more details), 1.8 Å

PDB Description: Crystal structure of the SPOC domain of the human transcriptional corepressor, SHARP.

SCOP Domain Sequences for d1ow1a_:

Sequence, based on SEQRES records: (download)

>d1ow1a_ b.131.1.3 (A:) SMART/HDAC1 associated repressor protein, SHARP {Human (Homo sapiens)}
pvdmvqllkkypivwqgllalkndtaavqlhfvsgnnvlahrslplseggpplriaqrmr
leatqlegvarrmtvetdyclllalpcgrdqedvvsqteslkaafitylqakqaagiinv
pnpgsnqpayvlqifppcefseshlsrlapdllasisnisphlmiviasv

Sequence, based on observed residues (ATOM records): (download)

>d1ow1a_ b.131.1.3 (A:) SMART/HDAC1 associated repressor protein, SHARP {Human (Homo sapiens)}
pvdmvqllkkypivwqgllalkndtaavqlhfvsgnnvlahrslplspplriaqrmrlea
tqlegvarrmtvetdyclllalpcgrdqedvvsqteslkaafitylqakqaagiinvpnp
gsnqpayvlqifppcefseshlsrlapdllasisnisphlmiviasv

SCOP Domain Coordinates for d1ow1a_:

Click to download the PDB-style file with coordinates for d1ow1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ow1a_: