Lineage for d1ovuc_ (1ovu C:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3047948Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 3047949Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 3047950Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 3047951Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 3047952Species Synthetic, different variants [58838] (12 PDB entries)
  8. 3047989Domain d1ovuc_: 1ovu C: [93614]
    complexed with co

Details for d1ovuc_

PDB Entry: 1ovu (more details), 3.1 Å

PDB Description: crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form i)
PDB Compounds: (C:) four-helix bundle model di-Co(II)-DF1-L13A (form I)

SCOPe Domain Sequences for d1ovuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovuc_ k.8.1.1 (C:) Artificial diiron protein {Synthetic, different variants}
dylrellklelqaikqyrealeyvklpvlakiledeekhiewletilg

SCOPe Domain Coordinates for d1ovuc_:

Click to download the PDB-style file with coordinates for d1ovuc_.
(The format of our PDB-style files is described here.)

Timeline for d1ovuc_: