Lineage for d1ovsc_ (1ovs C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409668Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2409669Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2409670Family b.115.1.1: Calcium-mediated lectin [82027] (3 protein domains)
    automatically mapped to Pfam PF07472
  6. 2409671Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 2409672Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries)
    Uniprot Q9HYN5 # PA3361
  8. 2409701Domain d1ovsc_: 1ovs C: [93610]
    complexed with ca

Details for d1ovsc_

PDB Entry: 1ovs (more details), 1.75 Å

PDB Description: LecB (PA-LII) in complex with core trimannoside
PDB Compounds: (C:) hypothetical protein LecB

SCOPe Domain Sequences for d1ovsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovsc_ b.115.1.1 (C:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d1ovsc_:

Click to download the PDB-style file with coordinates for d1ovsc_.
(The format of our PDB-style files is described here.)

Timeline for d1ovsc_: